![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) ![]() automatically mapped to Pfam PF04135 |
![]() | Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins) Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204) |
![]() | Protein Ribosome biogenesis protein Nop10 [144214] (2 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [144216] (2 PDB entries) Uniprot P81303 1-60 |
![]() | Domain d2apob_: 2apo B: [127135] Other proteins in same PDB: d2apoa1, d2apoa2 automated match to d2aqca1 protein/RNA complex; complexed with k, zn |
PDB Entry: 2apo (more details), 1.95 Å
SCOPe Domain Sequences for d2apob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2apob_ g.41.16.1 (B:) Ribosome biogenesis protein Nop10 {Methanococcus jannaschii [TaxId: 2190]} emrmkkcpkcglytlkeicpkcgektvipkppkfsledrwgkyrrmlkralknkn
Timeline for d2apob_: