Lineage for d2apob_ (2apo B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2642076Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) (S)
    automatically mapped to Pfam PF04135
  5. 2642077Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
    Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)
  6. 2642084Protein Ribosome biogenesis protein Nop10 [144214] (2 species)
  7. 2642085Species Methanococcus jannaschii [TaxId:2190] [144216] (2 PDB entries)
    Uniprot P81303 1-60
  8. 2642086Domain d2apob_: 2apo B: [127135]
    Other proteins in same PDB: d2apoa1, d2apoa2
    automated match to d2aqca1
    protein/RNA complex; complexed with k, zn

Details for d2apob_

PDB Entry: 2apo (more details), 1.95 Å

PDB Description: Crystal Structure of the Methanococcus jannaschii Cbf5 Nop10 Complex
PDB Compounds: (B:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d2apob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2apob_ g.41.16.1 (B:) Ribosome biogenesis protein Nop10 {Methanococcus jannaschii [TaxId: 2190]}
emrmkkcpkcglytlkeicpkcgektvipkppkfsledrwgkyrrmlkralknkn

SCOPe Domain Coordinates for d2apob_:

Click to download the PDB-style file with coordinates for d2apob_.
(The format of our PDB-style files is described here.)

Timeline for d2apob_: