Lineage for d2aqca1 (2aqc A:1-60)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037379Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) (S)
    automatically mapped to Pfam PF04135
  5. 3037380Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
    Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)
  6. 3037387Protein Ribosome biogenesis protein Nop10 [144214] (2 species)
  7. 3037388Species Methanococcus jannaschii [TaxId:2190] [144216] (2 PDB entries)
    Uniprot P81303 1-60
  8. 3037390Domain d2aqca1: 2aqc A:1-60 [127177]
    Other proteins in same PDB: d2aqca2
    complexed with zn

Details for d2aqca1

PDB Entry: 2aqc (more details)

PDB Description: nmr structural analysis of archaeal nop10
PDB Compounds: (A:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d2aqca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aqca1 g.41.16.1 (A:1-60) Ribosome biogenesis protein Nop10 {Methanococcus jannaschii [TaxId: 2190]}
mvemrmkkcpkcglytlkeicpkcgektvipkppkfsledrwgkyrrmlkralknknkae

SCOPe Domain Coordinates for d2aqca1:

Click to download the PDB-style file with coordinates for d2aqca1.
(The format of our PDB-style files is described here.)

Timeline for d2aqca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aqca2