Lineage for d2aqca1 (2aqc A:1-60)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) 
automatically mapped to Pfam PF04135Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)Protein Ribosome biogenesis protein Nop10 [144214] (2 species) Species Methanococcus jannaschii [TaxId:2190] [144216] (2 PDB entries)
Uniprot P81303 1-60
Domain d2aqca1: 2aqc A:1-60 [127177]
Other proteins in same PDB: d2aqca2
complexed with zn
Details for d2aqca1
PDB Entry: 2aqc (more details)
PDB Description: nmr structural analysis of archaeal nop10
PDB Compounds: (A:) Ribosome biogenesis protein Nop10SCOPe Domain Sequences for d2aqca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aqca1 g.41.16.1 (A:1-60) Ribosome biogenesis protein Nop10 {Methanococcus jannaschii [TaxId: 2190]}
mvemrmkkcpkcglytlkeicpkcgektvipkppkfsledrwgkyrrmlkralknknkae
SCOPe Domain Coordinates for d2aqca1:
Click to download the PDB-style file with coordinates for d2aqca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aqca1:
- d2aqca1 first appeared in SCOP 1.73
- d2aqca1 appears in SCOPe 2.07
View in 3D
