Lineage for d2apoa2 (2apo A:17-246)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009172Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 3009173Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 3009188Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
    contains C-terminal PUA domain
  6. 3009189Protein Pseudouridine synthase II TruB [69747] (5 species)
  7. 3009194Species Methanococcus jannaschii [TaxId:2190] [143435] (1 PDB entry)
    Uniprot Q57612 17-246
  8. 3009195Domain d2apoa2: 2apo A:17-246 [127134]
    Other proteins in same PDB: d2apoa1, d2apob_
    protein/RNA complex; complexed with k, zn
    has additional insertions and/or extensions that are not grouped together

Details for d2apoa2

PDB Entry: 2apo (more details), 1.95 Å

PDB Description: Crystal Structure of the Methanococcus jannaschii Cbf5 Nop10 Complex
PDB Compounds: (A:) Probable tRNA pseudouridine synthase B

SCOPe Domain Sequences for d2apoa2:

Sequence, based on SEQRES records: (download)

>d2apoa2 d.265.1.2 (A:17-246) Pseudouridine synthase II TruB {Methanococcus jannaschii [TaxId: 2190]}
elivkeevetnwdygcnpyerkiedlikygvvvvdkprgptshevstwvkkilnldkagh
ggtldpkvtgvlpvaleratktipmwhippkeyvclmhlhrdaseedilrvfkeftgriy
qrpplkaavkrrlrirkihelelldkdgkdvlfrvkcqsgtyirklcedigealgtsahm
qelrrtksgcfeekdavylqdlldayvfwkedgdeeelrrvikpmeyglr

Sequence, based on observed residues (ATOM records): (download)

>d2apoa2 d.265.1.2 (A:17-246) Pseudouridine synthase II TruB {Methanococcus jannaschii [TaxId: 2190]}
elivkeevetnwdygcnpyerkiedlikygvvvvdkprgptshevstwvkkilnldkagh
ggtldpkvtgvlpvaleratktipmwhippkeyvclmhlhrdaseedilrvfkeftgriy
qrrirkihelelldkdgkdvlfrvkcqsgtyirklcedigealgtsahmqelrrtksgcf
eekdavylqdlldayvfwkedgdeeelrrvikpmeyglr

SCOPe Domain Coordinates for d2apoa2:

Click to download the PDB-style file with coordinates for d2apoa2.
(The format of our PDB-style files is described here.)

Timeline for d2apoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2apoa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2apob_