![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.9: Coronavirus NSP7-like [140367] (2 families) ![]() |
![]() | Family a.8.9.1: Coronavirus NSP7-like [140368] (2 proteins) automatically mapped to Pfam PF08716 |
![]() | Protein automated matches [190477] (1 species) not a true protein |
![]() | Species SARS coronavirus [TaxId:227859] [187402] (2 PDB entries) |
![]() | Domain d2ahmd2: 2ahm D:6-76 [126763] Other proteins in same PDB: d2ahma1, d2ahma2, d2ahmb3, d2ahmc3, d2ahmd3, d2ahme1, d2ahmf_, d2ahmg1, d2ahmh1 automated match to d1ysya1 complexed with gol, so4 |
PDB Entry: 2ahm (more details), 2.4 Å
SCOPe Domain Sequences for d2ahmd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahmd2 a.8.9.1 (D:6-76) automated matches {SARS coronavirus [TaxId: 227859]} skmsdvkctsvvllsvlqqlrvesssklwaqcvqlhndillakdtteafekmvsllsvll smqgavdinrl
Timeline for d2ahmd2: