Lineage for d2ahmf_ (2ahm F:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.302: Coronavirus NSP8-like [143075] (1 superfamily)
    core: alpha-beta(2)-alpha-beta(4)-alpha-beta; bifurcated barrel-like beta-sheet
  4. Superfamily d.302.1: Coronavirus NSP8-like [143076] (1 family) (S)
    automatically mapped to Pfam PF08717
  5. Family d.302.1.1: Coronavirus NSP8-like [143077] (2 proteins)
  6. Protein Nonstructural protein 8, NSP8 [143078] (1 species)
    contains extra N-terminal helical regions involved in heterooligomerisation with NSP7
  7. Species SARS coronavirus [TaxId:227859] [143079] (1 PDB entry)
    Uniprot P59641 3961-4111
  8. Domain d2ahmf_: 2ahm F: [197748]
    Other proteins in same PDB: d2ahma1, d2ahma2, d2ahmb2, d2ahmb3, d2ahmc2, d2ahmc3, d2ahmd2, d2ahmd3
    automated match to d2ahme1
    complexed with gol, so4

Details for d2ahmf_

PDB Entry: 2ahm (more details), 2.4 Å

PDB Description: Crystal structure of SARS-CoV super complex of non-structural proteins: the hexadecamer
PDB Compounds: (F:) Replicase polyprotein 1ab, heavy chain

SCOPe Domain Sequences for d2ahmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahmf_ d.302.1.1 (F:) Nonstructural protein 8, NSP8 {SARS coronavirus [TaxId: 227859]}
drdaamqrklekmadqamtqmykqarsedkrakvtsamqtmlftmlrkldndalnniinn
ardgcvplniiplttaaklmvvvpdygtykntcdgntftyasalweiqqvvdadskivql
seinmdnspnlawplivtalran

SCOPe Domain Coordinates for d2ahmf_ are not available.

Timeline for d2ahmf_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ahma1, d2ahma2, d2ahmb2, d2ahmb3, d2ahmc2, d2ahmc3, d2ahmd2, d2ahmd3, d2ahme1, d2ahmg1, d2ahmh1