Lineage for d2ahmd1 (2ahm D:6-76)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636923Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (10 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 637057Superfamily a.8.9: Coronavirus NSP7-like [140367] (1 family) (S)
  5. 637058Family a.8.9.1: Coronavirus NSP7-like [140368] (1 protein)
  6. 637059Protein Nonstructural protein 7, NSP7 [140369] (1 species)
  7. 637060Species SARS coronavirus [TaxId:227859] [140370] (2 PDB entries)
  8. 637064Domain d2ahmd1: 2ahm D:6-76 [126763]
    Other proteins in same PDB: d2ahme1, d2ahmg1, d2ahmh1
    automatically matched to 2AHM A:6-78
    complexed with gol, so4

Details for d2ahmd1

PDB Entry: 2ahm (more details), 2.4 Å

PDB Description: Crystal structure of SARS-CoV super complex of non-structural proteins: the hexadecamer
PDB Compounds: (D:) Replicase polyprotein 1ab, light chain

SCOP Domain Sequences for d2ahmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahmd1 a.8.9.1 (D:6-76) Nonstructural protein 7, NSP7 {SARS coronavirus [TaxId: 227859]}
skmsdvkctsvvllsvlqqlrvesssklwaqcvqlhndillakdtteafekmvsllsvll
smqgavdinrl

SCOP Domain Coordinates for d2ahmd1:

Click to download the PDB-style file with coordinates for d2ahmd1.
(The format of our PDB-style files is described here.)

Timeline for d2ahmd1: