SCOPe 2.08: Domain d2ahmc2: 2ahm C:6-78

Lineage for d2ahmc2 (2ahm C:6-78)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.9: Coronavirus NSP7-like [140367] (2 families)

5. Family a.8.9.1: Coronavirus NSP7-like [140368] (2 proteins)
   automatically mapped to Pfam PF08716

6. Protein automated matches [190477] (1 species)
   not a true protein

7. Species SARS coronavirus [TaxId:227859] [187402] (2 PDB entries)

8. Domain d2ahmc2: 2ahm C:6-78 [126762]
   Other proteins in same PDB: d2ahma1, d2ahma2, d2ahmb3, d2ahmc3, d2ahmd3, d2ahme1, d2ahmf_, d2ahmg1, d2ahmh1
   automated match to d1ysya1
   complexed with gol, so4

Details for d2ahmc2

PDB Entry: 2ahm, 2.4 Å

PDB Description: Crystal structure of SARS-CoV super complex of non-structural proteins: the hexadecamer

PDB Compounds: (C:) Replicase polyprotein 1ab, light chain

SCOPe Domain Sequences for d2ahmc2:

Sequence; same for both SEQRES and ATOM records:

>d2ahmc2 a.8.9.1 (C:6-78) automated matches {SARS coronavirus [TaxId: 227859]}
skmsdvkctsvvllsvlqqlrvesssklwaqcvqlhndillakdtteafekmvsllsvll
smqgavdinrlce

Timeline for d2ahmc2:

• d2ahmc2 first appeared in SCOP 1.73, called d2ahmc1
  
• d2ahmc2 appears in SCOPe 2.07