Lineage for d2ahma1 (2ahm A:6-78)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309262Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2309592Superfamily a.8.9: Coronavirus NSP7-like [140367] (2 families) (S)
  5. 2309593Family a.8.9.1: Coronavirus NSP7-like [140368] (2 protein domains)
    automatically mapped to Pfam PF08716
  6. 2309594Protein Nonstructural protein 7, NSP7 [140369] (1 species)
  7. 2309595Species SARS coronavirus [TaxId:227859] [140370] (2 PDB entries)
    Uniprot P59641 3837-3909! Uniprot P59641 3837-3919
  8. 2309596Domain d2ahma1: 2ahm A:6-78 [126760]
    Other proteins in same PDB: d2ahma2, d2ahmb2, d2ahmb3, d2ahmc2, d2ahmc3, d2ahmd2, d2ahmd3, d2ahme1, d2ahmf_, d2ahmg1, d2ahmh1
    complexed with gol, so4

Details for d2ahma1

PDB Entry: 2ahm (more details), 2.4 Å

PDB Description: Crystal structure of SARS-CoV super complex of non-structural proteins: the hexadecamer
PDB Compounds: (A:) Replicase polyprotein 1ab, light chain

SCOPe Domain Sequences for d2ahma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahma1 a.8.9.1 (A:6-78) Nonstructural protein 7, NSP7 {SARS coronavirus [TaxId: 227859]}
skmsdvkctsvvllsvlqqlrvesssklwaqcvqlhndillakdtteafekmvsllsvll
smqgavdinrlce

SCOPe Domain Coordinates for d2ahma1:

Click to download the PDB-style file with coordinates for d2ahma1.
(The format of our PDB-style files is described here.)

Timeline for d2ahma1: