![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.302: Coronavirus NSP8-like [143075] (1 superfamily) core: alpha-beta(2)-alpha-beta(4)-alpha-beta; bifurcated barrel-like beta-sheet |
![]() | Superfamily d.302.1: Coronavirus NSP8-like [143076] (1 family) ![]() automatically mapped to Pfam PF08717 |
![]() | Family d.302.1.1: Coronavirus NSP8-like [143077] (2 proteins) |
![]() | Protein Nonstructural protein 8, NSP8 [143078] (1 species) contains extra N-terminal helical regions involved in heterooligomerisation with NSP7 |
![]() | Species SARS coronavirus [TaxId:227859] [143079] (1 PDB entry) Uniprot P59641 3961-4111 |
![]() | Domain d2ahmg1: 2ahm G:43-196 [126765] Other proteins in same PDB: d2ahma1, d2ahma2, d2ahmb2, d2ahmb3, d2ahmc2, d2ahmc3, d2ahmd2, d2ahmd3 automatically matched to 2AHM E:43-197 complexed with gol, so4 |
PDB Entry: 2ahm (more details), 2.4 Å
SCOPe Domain Sequences for d2ahmg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahmg1 d.302.1.1 (G:43-196) Nonstructural protein 8, NSP8 {SARS coronavirus [TaxId: 227859]} lkkslnvaksefdrdaamqrklekmadqamtqmykqarsedkrakvtsamqtmlftmlrk ldndalnniinnardgcvplniiplttaaklmvvvpdygtykntcdgntftyasalweiq qvvdadskivqlseinmdnspnlawplivtalra
Timeline for d2ahmg1: