SCOPe 2.08: Domain d2a61c_: 2a61 C:

Lineage for d2a61c_ (2a61 C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein automated matches [190294] (6 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [187380] (1 PDB entry)

8. Domain d2a61c_: 2a61 C: [126189]
   Other proteins in same PDB: d2a61a1
   automated match to d2a61a1

Details for d2a61c_

PDB Entry: 2a61, 1.8 Å

PDB Description: The crystal structure of transcriptional regulator Tm0710 from Thermotoga maritima

PDB Compounds: (C:) transcriptional regulator Tm0710

SCOPe Domain Sequences for d2a61c_:

Sequence; same for both SEQRES and ATOM records:

>d2a61c_ a.4.5.28 (C:) automated matches {Thermotoga maritima [TaxId: 2336]}
kqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgvakst
vtglvkrleadgyltrtpdpadrrayflvitrkgeeviekvierrenfiekitsdlgkek
sskildylkelkgvmernfskq

Timeline for d2a61c_:

• d2a61c_ first appeared in SCOP 1.73, called d2a61c1
  
• d2a61c_ appears in SCOPe 2.07