PDB entry 2a61

View 2a61 on RCSB PDB site
Description: The crystal structure of transcriptional regulator Tm0710 from Thermotoga maritima
Class: transcription
Keywords: TM0710, APC4350, MCSG, Midwest Center for Structural Genomics, PSI, Protein structure Initiative, transcriptional regulator, MarR
Deposited on 2005-07-01, released 2005-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.213
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator Tm0710
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • GB NP_228519 (Start-144)
    Domains in SCOPe 2.08: d2a61a1
  • Chain 'B':
    Compound: transcriptional regulator Tm0710
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • GB NP_228519
    Domains in SCOPe 2.08: d2a61b_
  • Chain 'C':
    Compound: transcriptional regulator Tm0710
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • GB NP_228519 (Start-144)
    Domains in SCOPe 2.08: d2a61c_
  • Chain 'D':
    Compound: transcriptional regulator Tm0710
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • GB NP_228519
    Domains in SCOPe 2.08: d2a61d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a61A (A:)
    gsmkqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgva
    kstvtglvkrleadgyltrtpdpadrrayflvitrkgeeviekvierrenfiekitsdlg
    keksskildylkelkgvmernfskq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a61A (A:)
    kqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgvakst
    vtglvkrleadgyltrtpdpadrrayflvitrkgeeviekvierrenfiekitsdlgkek
    sskildylkelkgvmernfskq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a61B (B:)
    gsmkqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgva
    kstvtglvkrleadgyltrtpdpadrrayflvitrkgeeviekvierrenfiekitsdlg
    keksskildylkelkgvmernfskq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a61B (B:)
    kqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgvakst
    vtglvkrleadgyltrtpdrayflvitrkgeeviekvierrenfiekitsdlgkeksski
    ldylkelkgvmernfsk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a61C (C:)
    gsmkqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgva
    kstvtglvkrleadgyltrtpdpadrrayflvitrkgeeviekvierrenfiekitsdlg
    keksskildylkelkgvmernfskq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a61C (C:)
    kqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgvakst
    vtglvkrleadgyltrtpdpadrrayflvitrkgeeviekvierrenfiekitsdlgkek
    sskildylkelkgvmernfskq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a61D (D:)
    gsmkqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgva
    kstvtglvkrleadgyltrtpdpadrrayflvitrkgeeviekvierrenfiekitsdlg
    keksskildylkelkgvmernfskq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a61D (D:)
    kqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgvakst
    vtglvkrleadgyltrtpdrayflvitrkgeeviekvierrenfiekitsdlgkeksski
    ldylkelkgvmernfsk