Lineage for d2a61a1 (2a61 A:5-143)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693813Protein Transcriptional regulator TM0710 [140253] (1 species)
  7. 2693814Species Thermotoga maritima [TaxId:2336] [140254] (1 PDB entry)
    Uniprot Q9WZG9 5-143
  8. 2693815Domain d2a61a1: 2a61 A:5-143 [126187]
    Other proteins in same PDB: d2a61b_, d2a61c_, d2a61d_

Details for d2a61a1

PDB Entry: 2a61 (more details), 1.8 Å

PDB Description: The crystal structure of transcriptional regulator Tm0710 from Thermotoga maritima
PDB Compounds: (A:) transcriptional regulator Tm0710

SCOPe Domain Sequences for d2a61a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]}
kqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgvakst
vtglvkrleadgyltrtpdpadrrayflvitrkgeeviekvierrenfiekitsdlgkek
sskildylkelkgvmernf

SCOPe Domain Coordinates for d2a61a1:

Click to download the PDB-style file with coordinates for d2a61a1.
(The format of our PDB-style files is described here.)

Timeline for d2a61a1: