![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
![]() | Protein automated matches [190294] (6 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:2336] [187380] (1 PDB entry) |
![]() | Domain d2a61b_: 2a61 B: [126188] Other proteins in same PDB: d2a61a1 automated match to d2a61a1 |
PDB Entry: 2a61 (more details), 1.8 Å
SCOPe Domain Sequences for d2a61b_:
Sequence, based on SEQRES records: (download)
>d2a61b_ a.4.5.28 (B:) automated matches {Thermotoga maritima [TaxId: 2336]} kqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgvakst vtglvkrleadgyltrtpdpadrrayflvitrkgeeviekvierrenfiekitsdlgkek sskildylkelkgvmernfsk
>d2a61b_ a.4.5.28 (B:) automated matches {Thermotoga maritima [TaxId: 2336]} kqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgvakst vtglvkrleadgyltrtpdrayflvitrkgeeviekvierrenfiekitsdlgkeksski ldylkelkgvmernfsk
Timeline for d2a61b_: