![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein Sepiapterin reductase [51767] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141874] (14 PDB entries) Uniprot P35270 5-261 |
![]() | Domain d1z6ze2: 1z6z E:2-258 [124579] Other proteins in same PDB: d1z6za2, d1z6zb3, d1z6zc3, d1z6zd3, d1z6ze3, d1z6zf3 automated match to d1z6za1 complexed with cl, nap, so4 |
PDB Entry: 1z6z (more details), 2.5 Å
SCOPe Domain Sequences for d1z6ze2:
Sequence, based on SEQRES records: (download)
>d1z6ze2 c.2.1.2 (E:2-258) Sepiapterin reductase {Human (Homo sapiens) [TaxId: 9606]} lgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrvv rvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnnyw alnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqvl aleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqkllsl lekdefksgahvdfydk
>d1z6ze2 c.2.1.2 (E:2-258) Sepiapterin reductase {Human (Homo sapiens) [TaxId: 9606]} lgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaellrvvrvpadl gaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnnywalnlts mlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqvlaleepn vrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqkllsllekdef ksgahvdfydk
Timeline for d1z6ze2: