SCOPe 2.08: Domain d1z6za1: 1z6z A:2-258

Lineage for d1z6za1 (1z6z A:2-258)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
also known as short-chain dehydrogenases and SDR family
parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
has additional subdomain(s) that are not in the common domain

Protein Sepiapterin reductase [51767] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [141874] (14 PDB entries)
Uniprot P35270 5-261
Domain d1z6za1: 1z6z A:2-258 [124575]
Other proteins in same PDB: d1z6za2, d1z6zb3, d1z6zc3, d1z6zd3, d1z6ze3, d1z6zf3
complexed with cl, nap, so4

Details for d1z6za1

PDB Entry: 1z6z (more details), 2.5 Å

PDB Description: crystal structure of human sepiapterin reductase in complex with nadp+

PDB Compounds: (A:) sepiapterin reductase

SCOPe Domain Sequences for d1z6za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6za1 c.2.1.2 (A:2-258) Sepiapterin reductase {Human (Homo sapiens) [TaxId: 9606]}
lgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrvv
rvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnnyw
alnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqvl
aleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqkllsl
lekdefksgahvdfydk

SCOPe Domain Coordinates for d1z6za1:

Click to download the PDB-style file with coordinates for d1z6za1.
(The format of our PDB-style files is described here.)

Timeline for d1z6za1: