Lineage for d1z6zb2 (1z6z B:2-258)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842760Protein Sepiapterin reductase [51767] (2 species)
  7. 2842761Species Human (Homo sapiens) [TaxId:9606] [141874] (14 PDB entries)
    Uniprot P35270 5-261
  8. 2842797Domain d1z6zb2: 1z6z B:2-258 [124576]
    Other proteins in same PDB: d1z6za2, d1z6zb3, d1z6zc3, d1z6zd3, d1z6ze3, d1z6zf3
    automated match to d1z6za1
    complexed with cl, nap, so4

Details for d1z6zb2

PDB Entry: 1z6z (more details), 2.5 Å

PDB Description: crystal structure of human sepiapterin reductase in complex with nadp+
PDB Compounds: (B:) sepiapterin reductase

SCOPe Domain Sequences for d1z6zb2:

Sequence, based on SEQRES records: (download)

>d1z6zb2 c.2.1.2 (B:2-258) Sepiapterin reductase {Human (Homo sapiens) [TaxId: 9606]}
lgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrvv
rvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnnyw
alnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqvl
aleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqkllsl
lekdefksgahvdfydk

Sequence, based on observed residues (ATOM records): (download)

>d1z6zb2 c.2.1.2 (B:2-258) Sepiapterin reductase {Human (Homo sapiens) [TaxId: 9606]}
lgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelrsglrvvrvp
adlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnnywaln
ltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqvlale
epnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqkllsllek
defksgahvdfydk

SCOPe Domain Coordinates for d1z6zb2:

Click to download the PDB-style file with coordinates for d1z6zb2.
(The format of our PDB-style files is described here.)

Timeline for d1z6zb2: