PDB entry 1z6z

View 1z6z on RCSB PDB site
Description: Crystal Structure of Human Sepiapterin Reductase in complex with NADP+
Class: oxidoreductase
Keywords: short-chain dehydrogenase/reductase, sepiapterin reductase, human, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
Deposited on 2005-03-23, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35270 (23-279)
      • cloning artifact (16-22)
    Domains in SCOPe 2.07: d1z6za1, d1z6za2
  • Chain 'B':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35270 (23-279)
      • cloning artifact (16-22)
    Domains in SCOPe 2.07: d1z6zb2, d1z6zb3
  • Chain 'C':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35270 (23-279)
      • cloning artifact (16-22)
    Domains in SCOPe 2.07: d1z6zc2, d1z6zc3
  • Chain 'D':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35270 (23-279)
      • cloning artifact (16-22)
    Domains in SCOPe 2.07: d1z6zd2, d1z6zd3
  • Chain 'E':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35270 (23-279)
      • cloning artifact (17-22)
    Domains in SCOPe 2.07: d1z6ze2, d1z6ze3
  • Chain 'F':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35270 (23-279)
      • cloning artifact (16-22)
    Domains in SCOPe 2.07: d1z6zf2, d1z6zf3
  • Heterogens: SO4, CL, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z6zA (A:)
    mgsshhhhhhssgrenlyfqghmlgravclltgasrgfgrtlapllasllspgsvlvlsa
    rndealrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinna
    gslgdvskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcal
    qpfkgwalycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkg
    lqelkakgklvdckvsaqkllsllekdefksgahvdfydkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6zA (A:)
    lyfqghmlgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgae
    rsglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsds
    tqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaar
    dmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvs
    aqkllsllekdefksgahvdfydk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z6zB (B:)
    mgsshhhhhhssgrenlyfqghmlgravclltgasrgfgrtlapllasllspgsvlvlsa
    rndealrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinna
    gslgdvskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcal
    qpfkgwalycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkg
    lqelkakgklvdckvsaqkllsllekdefksgahvdfydkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6zB (B:)
    lyfqghmlgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelrsg
    lrvvrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqv
    nnywalnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardml
    fqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqk
    llsllekdefksgahvdfydk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z6zC (C:)
    mgsshhhhhhssgrenlyfqghmlgravclltgasrgfgrtlapllasllspgsvlvlsa
    rndealrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinna
    gslgdvskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcal
    qpfkgwalycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkg
    lqelkakgklvdckvsaqkllsllekdefksgahvdfydkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6zC (C:)
    lyfqghmlgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgae
    rsglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsds
    tqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaar
    dmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvs
    aqkllsllekdefksgahvdfydk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z6zD (D:)
    mgsshhhhhhssgrenlyfqghmlgravclltgasrgfgrtlapllasllspgsvlvlsa
    rndealrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinna
    gslgdvskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcal
    qpfkgwalycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkg
    lqelkakgklvdckvsaqkllsllekdefksgahvdfydkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6zD (D:)
    lyfqghmlgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaellrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfydk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1z6zE (E:)
    mgsshhhhhhssgrenlyfqghmlgravclltgasrgfgrtlapllasllspgsvlvlsa
    rndealrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinna
    gslgdvskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcal
    qpfkgwalycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkg
    lqelkakgklvdckvsaqkllsllekdefksgahvdfydkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6zE (E:)
    yfqghmlgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaellrvv
    rvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnnyw
    alnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqvl
    aleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqkllsl
    lekdefksgahvdfydk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1z6zF (F:)
    mgsshhhhhhssgrenlyfqghmlgravclltgasrgfgrtlapllasllspgsvlvlsa
    rndealrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinna
    gslgdvskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcal
    qpfkgwalycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkg
    lqelkakgklvdckvsaqkllsllekdefksgahvdfydkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6zF (F:)
    lyfqghmlgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaellrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfydk