SCOPe 2.08: Domain d1xved_: 1xve D:

Lineage for d1xved_ (1xve D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)

8. Domain d1xved_: 1xve D: [122365]
   Other proteins in same PDB: d1xvea_, d1xveb_, d1xvee_, d1xvef_
   automated match to d1fyzc_
   complexed with 3bb, ca, fe
   has additional insertions and/or extensions that are not grouped together

Details for d1xved_

PDB Entry: 1xve, 2.4 Å

PDB Description: soluble methane monooxygenase hydroxylase: 3-bromo-3-butenol soaked structure

PDB Compounds: (D:) Methane monooxygenase component A beta chain

SCOPe Domain Sequences for d1xved_:

Sequence; same for both SEQRES and ATOM records:

>d1xved_ a.25.1.2 (D:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

Timeline for d1xved_:

• d1xved_ first appeared in SCOP 1.73, called d1xved1
  
• d1xved_ appears in SCOPe 2.07