Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein Methane monooxygenase hydrolase alpha subunit [88789] (2 species) |
Species Methylococcus capsulatus [TaxId:414] [88790] (26 PDB entries) |
Domain d1xveb_: 1xve B: [122363] Other proteins in same PDB: d1xvec_, d1xved_, d1xvee_, d1xvef_ automated match to d1fz1a_ complexed with 3bb, ca, fe has additional subdomain(s) that are not in the common domain |
PDB Entry: 1xve (more details), 2.4 Å
SCOPe Domain Sequences for d1xveb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xveb_ a.25.1.2 (B:) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus [TaxId: 414]} raptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkder qfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkngy laqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgda vecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvsi andpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggiw igrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeanyp gwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastlr vheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktlia qphvrgdklwtlddikrlncvfknpvkafn
Timeline for d1xveb_: