SCOPe 2.08: Domain d1xvee_: 1xve E:

Lineage for d1xvee_ (1xve E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold
   automatically mapped to Pfam PF02964

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)

8. Domain d1xvee_: 1xve E: [122366]
   Other proteins in same PDB: d1xvea_, d1xveb_, d1xvec_, d1xved_
   automated match to d1fyzf_
   complexed with 3bb, ca, fe

Details for d1xvee_

PDB Entry: 1xve, 2.4 Å

PDB Description: soluble methane monooxygenase hydroxylase: 3-bromo-3-butenol soaked structure

PDB Compounds: (E:) Methane monooxygenase component A gamma chain

SCOPe Domain Sequences for d1xvee_:

Sequence; same for both SEQRES and ATOM records:

>d1xvee_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

Timeline for d1xvee_:

• d1xvee_ first appeared in SCOP 1.73, called d1xvee1
  
• d1xvee_ appears in SCOPe 2.07