Lineage for d1fyzc_ (1fyz C:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)
  8. Domain d1fyzc_: 1fyz C: [16762]
    Other proteins in same PDB: d1fyza_, d1fyzb_, d1fyze_, d1fyzf_
    complexed with ca, fe2

Details for d1fyzc_

PDB Entry: 1fyz (more details), 2.15 Å

PDB Description: methane monooxygenase hydroxylase, form ii reduced by soaking
PDB Compounds: (C:) methane monooxygenase component a, beta chain

SCOPe Domain Sequences for d1fyzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyzc_ a.25.1.2 (C:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOPe Domain Coordinates for d1fyzc_ are not available.

Timeline for d1fyzc_:

Domains from other chains:
(mouse over for more information)
d1fyza_, d1fyzb_, d1fyzd_, d1fyze_, d1fyzf_