SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ul1x2 (1ul1 X:2-217)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150569Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2150570Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 2150626Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 protein domains)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 2150633Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species)
  7. 2150638Species Human (Homo sapiens) [TaxId:9606] [142118] (1 PDB entry)
    Uniprot P39748 2-217
  8. 2150639Domain d1ul1x2: 1ul1 X:2-217 [119691]
    Other proteins in same PDB: d1ul1a1, d1ul1a2, d1ul1b1, d1ul1b2, d1ul1c1, d1ul1c2, d1ul1x1, d1ul1y1, d1ul1z1
    protein/DNA complex; complexed with mg

Details for d1ul1x2

PDB Entry: 1ul1 (more details), 2.9 Å

PDB Description: Crystal structure of the human FEN1-PCNA complex
PDB Compounds: (X:) Flap Endonuclease-1

SCOPe Domain Sequences for d1ul1x2:

Sequence, based on SEQRES records: (download)

>d1ul1x2 c.120.1.2 (X:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]}
giqglakliadvapsairendiksyfgrkvaidasmsiyqfliavrqggdvlqneegett
shlmgmfyrtirmmengikpvyvfdgkppqlksgelakrserraeaekqlqqaqaagaeq
evekftkrlvkvtkqhndeckhllslmgipyldapseaeascaalvkagkvyaaatedmd
cltfgspvlmrhltaseakklpiqefhlsrilqelg

Sequence, based on observed residues (ATOM records): (download)

>d1ul1x2 c.120.1.2 (X:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]}
giqglakliadvapsairendiksyfgrkvaidasmsiyqfliavttshlmgmfyrtirm
mengikpvyvfdgkppqlksgelakrlvkvtkqhndeckhllslmgipyldapseaeasc
aalvkagkvyaaatedmdcltfgspvlmrhltasekklpiqefhlsrilqelg

SCOPe Domain Coordinates for d1ul1x2:

Click to download the PDB-style file with coordinates for d1ul1x2.
(The format of our PDB-style files is described here.)

Timeline for d1ul1x2: