SCOPe 2.08: Domain d1ul1y1: 1ul1 Y:218-359

Lineage for d1ul1y1 (1ul1 Y:218-359)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein Flap endonuclease-1 (Fen-1 nuclease) [47815] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140638] (1 PDB entry)
   Uniprot P39748 218-357

8. Domain d1ul1y1: 1ul1 Y:218-359 [119692]
   Other proteins in same PDB: d1ul1a1, d1ul1a2, d1ul1b1, d1ul1b2, d1ul1c1, d1ul1c2, d1ul1x2, d1ul1y2, d1ul1z2
   automated match to d1ul1x1
   protein/DNA complex; complexed with mg

Details for d1ul1y1

PDB Entry: 1ul1, 2.9 Å

PDB Description: Crystal structure of the human FEN1-PCNA complex

PDB Compounds: (Y:) Flap Endonuclease-1

SCOPe Domain Sequences for d1ul1y1:

Sequence; same for both SEQRES and ATOM records:

>d1ul1y1 a.60.7.1 (Y:218-359) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]}
lnqeqfvdlcillgsdycesirgigpkravdliqkhksieeivrrldpnkypvpenwlhk
eahqlflepevldpesvelkwsepneeelikfmcgekqfseerirsgvkrlsksrqgstq
grlddffkvtgslssakrkepe

Timeline for d1ul1y1:

• d1ul1y1 first appeared in SCOP 1.73
  
• d1ul1y1 appears in SCOPe 2.07