PDB entry 1ul1

View 1ul1 on RCSB PDB site
Description: Crystal structure of the human FEN1-PCNA complex
Class: hydrolase/DNA binding protein
Keywords: protein complex, DNA-binding protein, Flap DNA, Flap endonuclease, sliding clamp, DNA clamp, replication, DNA repair, HYDROLASE/DNA BINDING PROTEIN COMPLEX
Deposited on 2003-09-05, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.22
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ul1a1, d1ul1a2
  • Chain 'B':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ul1b1, d1ul1b2
  • Chain 'C':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ul1c1, d1ul1c2
  • Chain 'X':
    Compound: Flap Endonuclease-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ul1x1, d1ul1x2
  • Chain 'Y':
    Compound: Flap Endonuclease-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ul1y1, d1ul1y2
  • Chain 'Z':
    Compound: Flap Endonuclease-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ul1z1, d1ul1z2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ul1A (A:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiedeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ul1A (A:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtskeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiad
    mghlkyylapkiedee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ul1B (B:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiedeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ul1B (B:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiede
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ul1C (C:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiedeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ul1C (C:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapki
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1ul1X (X:)
    giqglakliadvapsairendiksyfgrkvaidasmsiyqfliavrqggdvlqneegett
    shlmgmfyrtirmmengikpvyvfdgkppqlksgelakrserraeaekqlqqaqaagaeq
    evekftkrlvkvtkqhndeckhllslmgipyldapseaeascaalvkagkvyaaatedmd
    cltfgspvlmrhltaseakklpiqefhlsrilqelglnqeqfvdlcillgsdycesirgi
    gpkravdliqkhksieeivrrldpnkypvpenwlhkeahqlflepevldpesvelkwsep
    neeelikfmcgekqfseerirsgvkrlsksrqgstqgrlddffkvtgslssakrkepepk
    gstkkkaktgaagkfkrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ul1X (X:)
    giqglakliadvapsairendiksyfgrkvaidasmsiyqfliavttshlmgmfyrtirm
    mengikpvyvfdgkppqlksgelakrlvkvtkqhndeckhllslmgipyldapseaeasc
    aalvkagkvyaaatedmdcltfgspvlmrhltasekklpiqefhlsrilqelglnqeqfv
    dlcillgsdycesirgigpkravdliqkhksieeivrrldpnkypvpenwlhkeahqlfl
    epevldpesvelkwsepneeelikfmcgekqfseerirsgvkrlsksrqgstqgrlddff
    kvtgslssakrke
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1ul1Y (Y:)
    giqglakliadvapsairendiksyfgrkvaidasmsiyqfliavrqggdvlqneegett
    shlmgmfyrtirmmengikpvyvfdgkppqlksgelakrserraeaekqlqqaqaagaeq
    evekftkrlvkvtkqhndeckhllslmgipyldapseaeascaalvkagkvyaaatedmd
    cltfgspvlmrhltaseakklpiqefhlsrilqelglnqeqfvdlcillgsdycesirgi
    gpkravdliqkhksieeivrrldpnkypvpenwlhkeahqlflepevldpesvelkwsep
    neeelikfmcgekqfseerirsgvkrlsksrqgstqgrlddffkvtgslssakrkepepk
    gstkkkaktgaagkfkrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ul1Y (Y:)
    giqglakliadvapsairendiksyfgrkvaidasmsiyqflittshlmgmfyrtirmme
    ngikpvyvfdgkppqlksgelakrsetkqhndeckhllslmgipyldapseaeascaalv
    kagkvyaaatedmdcltfgspvlmrhltaseakklpiqefhlsrilqelglnqeqfvdlc
    illgsdycesirgigpkravdliqkhksieeivrrldpnkypvpenwlhkeahqlflepe
    vldpesvelkwsepneeelikfmcgekqfseerirsgvkrlsksrqgstqgrlddffkvt
    gslssakrkepe
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1ul1Z (Z:)
    giqglakliadvapsairendiksyfgrkvaidasmsiyqfliavrqggdvlqneegett
    shlmgmfyrtirmmengikpvyvfdgkppqlksgelakrserraeaekqlqqaqaagaeq
    evekftkrlvkvtkqhndeckhllslmgipyldapseaeascaalvkagkvyaaatedmd
    cltfgspvlmrhltaseakklpiqefhlsrilqelglnqeqfvdlcillgsdycesirgi
    gpkravdliqkhksieeivrrldpnkypvpenwlhkeahqlflepevldpesvelkwsep
    neeelikfmcgekqfseerirsgvkrlsksrqgstqgrlddffkvtgslssakrkepepk
    gstkkkaktgaagkfkrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ul1Z (Z:)
    giqglakliadvapsairendiksyfgrkvaidasmsiyqfliavrqggdvlqneegett
    shlmgmfyrtirmmengikpvyvfdgkppqlksgelakrserraeaekqlqqeqevekft
    krlvkvtkqhndeckhllslmgipyldapseaeascaalvkagkvyaaatedmdcltfgs
    pvlmrhltaseakklpiqefhlsrilqelglnqeqfvdlcillgsdycesirgigpkrav
    dliqkhksieeivrrldpnkypvpenwlhkeahqlflepevldpesvelkwsepneeeli
    kfmcgekqfseerirsgvkrlsksrqgstqgrlddffkvtgslssakrk