Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (4 families) |
Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins) contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold |
Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [142118] (1 PDB entry) Uniprot P39748 2-217 |
Domain d1ul1y2: 1ul1 Y:2-217 [119693] Other proteins in same PDB: d1ul1a1, d1ul1a2, d1ul1b1, d1ul1b2, d1ul1c1, d1ul1c2, d1ul1x1, d1ul1y1, d1ul1z1 automated match to d1ul1x2 protein/DNA complex; complexed with mg missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1ul1 (more details), 2.9 Å
SCOPe Domain Sequences for d1ul1y2:
Sequence, based on SEQRES records: (download)
>d1ul1y2 c.120.1.2 (Y:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} giqglakliadvapsairendiksyfgrkvaidasmsiyqfliavrqggdvlqneegett shlmgmfyrtirmmengikpvyvfdgkppqlksgelakrserraeaekqlqqaqaagaeq evekftkrlvkvtkqhndeckhllslmgipyldapseaeascaalvkagkvyaaatedmd cltfgspvlmrhltaseakklpiqefhlsrilqelg
>d1ul1y2 c.120.1.2 (Y:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} giqglakliadvapsairendiksyfgrkvaidasmsiyqflittshlmgmfyrtirmme ngikpvyvfdgkppqlksgelakrsetkqhndeckhllslmgipyldapseaeascaalv kagkvyaaatedmdcltfgspvlmrhltaseakklpiqefhlsrilqelg
Timeline for d1ul1y2: