Lineage for d1ul1z2 (1ul1 Z:2-217)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921858Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2921859Superfamily c.120.1: PIN domain-like [88723] (4 families) (S)
  5. 2921920Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 2921927Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species)
  7. 2921932Species Human (Homo sapiens) [TaxId:9606] [142118] (1 PDB entry)
    Uniprot P39748 2-217
  8. 2921935Domain d1ul1z2: 1ul1 Z:2-217 [119695]
    Other proteins in same PDB: d1ul1a1, d1ul1a2, d1ul1b1, d1ul1b2, d1ul1c1, d1ul1c2, d1ul1x1, d1ul1y1, d1ul1z1
    automated match to d1ul1x2
    protein/DNA complex; complexed with mg

    missing some secondary structures that made up less than one-third of the common domain

Details for d1ul1z2

PDB Entry: 1ul1 (more details), 2.9 Å

PDB Description: Crystal structure of the human FEN1-PCNA complex
PDB Compounds: (Z:) Flap Endonuclease-1

SCOPe Domain Sequences for d1ul1z2:

Sequence, based on SEQRES records: (download)

>d1ul1z2 c.120.1.2 (Z:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]}
giqglakliadvapsairendiksyfgrkvaidasmsiyqfliavrqggdvlqneegett
shlmgmfyrtirmmengikpvyvfdgkppqlksgelakrserraeaekqlqqaqaagaeq
evekftkrlvkvtkqhndeckhllslmgipyldapseaeascaalvkagkvyaaatedmd
cltfgspvlmrhltaseakklpiqefhlsrilqelg

Sequence, based on observed residues (ATOM records): (download)

>d1ul1z2 c.120.1.2 (Z:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]}
giqglakliadvapsairendiksyfgrkvaidasmsiyqfliavrqggdvlqneegett
shlmgmfyrtirmmengikpvyvfdgkppqlksgelakrserraeaekqlqqeqevekft
krlvkvtkqhndeckhllslmgipyldapseaeascaalvkagkvyaaatedmdcltfgs
pvlmrhltaseakklpiqefhlsrilqelg

SCOPe Domain Coordinates for d1ul1z2:

Click to download the PDB-style file with coordinates for d1ul1z2.
(The format of our PDB-style files is described here.)

Timeline for d1ul1z2: