Lineage for d1ul1z1 (1ul1 Z:218-356)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999281Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) (S)
  5. 1999282Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 protein domains)
  6. 1999289Protein Flap endonuclease-1 (Fen-1 nuclease) [47815] (5 species)
  7. 1999294Species Human (Homo sapiens) [TaxId:9606] [140638] (1 PDB entry)
    Uniprot P39748 218-357
  8. 1999297Domain d1ul1z1: 1ul1 Z:218-356 [119694]
    Other proteins in same PDB: d1ul1a1, d1ul1a2, d1ul1b1, d1ul1b2, d1ul1c1, d1ul1c2, d1ul1x2, d1ul1y2, d1ul1z2
    automated match to d1ul1x1
    protein/DNA complex; complexed with mg

Details for d1ul1z1

PDB Entry: 1ul1 (more details), 2.9 Å

PDB Description: Crystal structure of the human FEN1-PCNA complex
PDB Compounds: (Z:) Flap Endonuclease-1

SCOPe Domain Sequences for d1ul1z1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ul1z1 a.60.7.1 (Z:218-356) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]}
lnqeqfvdlcillgsdycesirgigpkravdliqkhksieeivrrldpnkypvpenwlhk
eahqlflepevldpesvelkwsepneeelikfmcgekqfseerirsgvkrlsksrqgstq
grlddffkvtgslssakrk

SCOPe Domain Coordinates for d1ul1z1:

Click to download the PDB-style file with coordinates for d1ul1z1.
(The format of our PDB-style files is described here.)

Timeline for d1ul1z1: