![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H3 [47122] (6 species) |
![]() | Species Mouse (Mus musculus), H3.1 [TaxId:10090] [140395] (1 PDB entry) Uniprot P68433 38-135 |
![]() | Domain d1u35a1: 1u35 A:438-535 [119493] Other proteins in same PDB: d1u35b_, d1u35c1, d1u35d1, d1u35f_, d1u35g_, d1u35h_ protein/DNA complex |
PDB Entry: 1u35 (more details), 3 Å
SCOPe Domain Sequences for d1u35a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u35a1 a.22.1.1 (A:438-535) Histone H3 {Mouse (Mus musculus), H3.1 [TaxId: 10090]} phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace aylvglfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d1u35a1: