Lineage for d1u35f_ (1u35 F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986516Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1986517Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1986518Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 1986958Protein automated matches [193445] (6 species)
    not a true protein
  7. 1987109Species Mouse (Mus musculus) [TaxId:10090] [254907] (1 PDB entry)
  8. 1987111Domain d1u35f_: 1u35 F: [119498]
    Other proteins in same PDB: d1u35a1, d1u35c1, d1u35d1, d1u35e1
    automated match to d1s32f_
    protein/DNA complex

Details for d1u35f_

PDB Entry: 1u35 (more details), 3 Å

PDB Description: Crystal structure of the nucleosome core particle containing the histone domain of macroH2A
PDB Compounds: (F:) Hist1h4i protein

SCOPe Domain Sequences for d1u35f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u35f_ a.22.1.1 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d1u35f_:

Click to download the PDB-style file with coordinates for d1u35f_.
(The format of our PDB-style files is described here.)

Timeline for d1u35f_: