Lineage for d1u35e1 (1u35 E:638-735)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698296Protein Histone H3 [47122] (6 species)
  7. 2698443Species Mouse (Mus musculus), H3.1 [TaxId:10090] [140395] (1 PDB entry)
    Uniprot P68433 38-135
  8. 2698445Domain d1u35e1: 1u35 E:638-735 [119497]
    Other proteins in same PDB: d1u35b_, d1u35c1, d1u35d1, d1u35f_, d1u35g_, d1u35h_
    automatically matched to 1U35 A:438-535
    protein/DNA complex

Details for d1u35e1

PDB Entry: 1u35 (more details), 3 Å

PDB Description: crystal structure of the nucleosome core particle containing the histone domain of macroh2a
PDB Compounds: (E:) Histone H3.1

SCOPe Domain Sequences for d1u35e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u35e1 a.22.1.1 (E:638-735) Histone H3 {Mouse (Mus musculus), H3.1 [TaxId: 10090]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace
aylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d1u35e1:

Click to download the PDB-style file with coordinates for d1u35e1.
(The format of our PDB-style files is described here.)

Timeline for d1u35e1: