SCOPe 2.08: Domain d1u35b_: 1u35 B:

Lineage for d1u35b_ (1u35 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (8 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [254907] (4 PDB entries)

8. Domain d1u35b_: 1u35 B: [119494]
   Other proteins in same PDB: d1u35a1, d1u35c1, d1u35d1, d1u35e1
   automated match to d1s32f_
   protein/DNA complex

Details for d1u35b_

PDB Entry: 1u35, 3 Å

PDB Description: crystal structure of the nucleosome core particle containing the histone domain of macroh2a

PDB Compounds: (B:) Hist1h4i protein

SCOPe Domain Sequences for d1u35b_:

Sequence; same for both SEQRES and ATOM records:

>d1u35b_ a.22.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

Timeline for d1u35b_:

• d1u35b_ first appeared in SCOP 1.73, called d1u35b1
  
• d1u35b_ appears in SCOPe 2.07