PDB entry 1u35

View 1u35 on RCSB PDB site
Description: Crystal structure of the nucleosome core particle containing the histone domain of macroH2A
Class: structural protein/DNA
Keywords: Nucleosome, NCP, Histone fold, Histone variant, macroH2A, structural protein/DNA COMPLEX
Deposited on 2004-07-20, released 2005-09-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.206
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.1
    Species: Mus musculus [TaxId:10090]
    Gene: H3FA, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u35a1
  • Chain 'B':
    Compound: Hist1h4i protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u35b_
  • Chain 'C':
    Compound: H2A histone family
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75367
      • engineered (64)
    Domains in SCOPe 2.06: d1u35c1
  • Chain 'D':
    Compound: Histone 3, H2ba
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u35d1
  • Chain 'E':
    Compound: Histone H3.1
    Species: Mus musculus [TaxId:10090]
    Gene: H3FA, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u35e1
  • Chain 'F':
    Compound: Hist1h4i protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u35f_
  • Chain 'G':
    Compound: H2A histone family
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75367
      • engineered (64)
    Domains in SCOPe 2.06: d1u35g_
  • Chain 'H':
    Compound: Histone 3, H2ba
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u35h_
  • Chain 'I':
    Compound: alpha-satellite DNA
    Species: Homo sapiens [TaxId:9606]
  • Chain 'J':
    Compound: alpha-satellite DNA
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u35A (A:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaceaylvglfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u35A (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace
    aylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u35B (B:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u35B (B:)
    dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
    mdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u35C (C:)
    mssrggkkkstktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaei
    lelavnaardnkkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakkrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u35C (C:)
    ktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaeilelavnaardn
    kkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u35D (D:)
    mpepsrstpapkkgskkaitkaqkkdgkkrkrgrkesysiyvykvlkqvhpdtgisskam
    gimnsfvndiferiaseasrlahynkrstitsrevqtavrlllpgelakhavsegtkavt
    kytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u35D (D:)
    rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstitsr
    evqtavrlllpgelakhavsegtkavtkytssk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u35E (E:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaceaylvglfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u35E (E:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace
    aylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1u35F (F:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u35F (F:)
    kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
    tvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1u35G (G:)
    mssrggkkkstktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaei
    lelavnaardnkkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakkrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u35G (G:)
    ktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaeilelavnaardn
    kkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1u35H (H:)
    mpepsrstpapkkgskkaitkaqkkdgkkrkrgrkesysiyvykvlkqvhpdtgisskam
    gimnsfvndiferiaseasrlahynkrstitsrevqtavrlllpgelakhavsegtkavt
    kytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u35H (H:)
    krgrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrsti
    tsrevqtavrlllpgelakhavsegtkavtkytssk
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.