SCOPe 2.08: Domain d1we3l1: 1we3 L:3-138,L:409-527

Lineage for d1we3l1 (1we3 L:3-138,L:409-527)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
   multihelical; 8 helices arranged in 2 parallel layers

4. Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families)
   duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site

5. Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)

6. Protein GroEL, E domain [48594] (4 species)

7. Species Thermus thermophilus [TaxId:274] [110024] (2 PDB entries)
   Uniprot P61491

8. Domain d1we3l1: 1we3 L:3-138,L:409-527 [109321]
   Other proteins in same PDB: d1we3a2, d1we3a3, d1we3b2, d1we3b3, d1we3c2, d1we3c3, d1we3d2, d1we3d3, d1we3e2, d1we3e3, d1we3f2, d1we3f3, d1we3g2, d1we3g3, d1we3h2, d1we3h3, d1we3i2, d1we3i3, d1we3j2, d1we3j3, d1we3k2, d1we3k3, d1we3l2, d1we3l3, d1we3m2, d1we3m3, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_
   complexed with adp, dms, mg
   complexed with adp, dms, mg

Details for d1we3l1

PDB Entry: 1we3, 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus

PDB Compounds: (L:) cpn60(GroEL)

SCOPe Domain Sequences for d1we3l1:

Sequence; same for both SEQRES and ATOM records:

>d1we3l1 a.129.1.1 (L:3-138,L:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]}
akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
aveaavekikalaipvXgivpgggvtllraisaveelikklegdeatgakivrraleepa
rqiaenagyegsvivqqilaetknprygfnaatgefvdmveagivdpakvtrsalqnaas
igaliltteavvaekp

Timeline for d1we3l1:

• d1we3l1 first appeared in SCOP 1.69
  
• d1we3l1 appears in SCOPe 2.07