![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily) multihelical; 8 helices arranged in 2 parallel layers |
![]() | Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) ![]() duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site |
![]() | Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein) |
![]() | Protein GroEL, E domain [48594] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [110024] (2 PDB entries) Uniprot P61491 |
![]() | Domain d1we3c1: 1we3 C:3-138,C:409-527 [109294] Other proteins in same PDB: d1we3a2, d1we3a3, d1we3b2, d1we3b3, d1we3c2, d1we3c3, d1we3d2, d1we3d3, d1we3e2, d1we3e3, d1we3f2, d1we3f3, d1we3g2, d1we3g3, d1we3h2, d1we3h3, d1we3i2, d1we3i3, d1we3j2, d1we3j3, d1we3k2, d1we3k3, d1we3l2, d1we3l3, d1we3m2, d1we3m3, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_ complexed with adp, dms, mg complexed with adp, dms, mg |
PDB Entry: 1we3 (more details), 2.8 Å
SCOPe Domain Sequences for d1we3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we3c1 a.129.1.1 (C:3-138,C:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]} akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek aveaavekikalaipvXgivpgggvtllraisaveelikklegdeatgakivrraleepa rqiaenagyegsvivqqilaetknprygfnaatgefvdmveagivdpakvtrsalqnaas igaliltteavvaekp
Timeline for d1we3c1:
![]() Domains from other chains: (mouse over for more information) d1we3a1, d1we3a2, d1we3a3, d1we3b1, d1we3b2, d1we3b3, d1we3d1, d1we3d2, d1we3d3, d1we3e1, d1we3e2, d1we3e3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_ |