PDB entry 1we3

View 1we3 on RCSB PDB site
Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
Class: chaperone
Keywords: chaperonin, chaperone, groel, groes, cpn60, cpn10, hsp60, hsp10, folding, ADP, ATP
Deposited on 2004-05-23, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.239
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3a1, d1we3a2, d1we3a3
  • Chain 'B':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3b1, d1we3b2, d1we3b3
  • Chain 'C':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3c1, d1we3c2, d1we3c3
  • Chain 'D':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3d1, d1we3d2, d1we3d3
  • Chain 'E':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3e1, d1we3e2, d1we3e3
  • Chain 'F':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3f1, d1we3f2, d1we3f3
  • Chain 'G':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3g1, d1we3g2, d1we3g3
  • Chain 'H':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3h1, d1we3h2, d1we3h3
  • Chain 'I':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3i1, d1we3i2, d1we3i3
  • Chain 'J':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3j1, d1we3j2, d1we3j3
  • Chain 'K':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3k1, d1we3k2, d1we3k3
  • Chain 'L':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3l1, d1we3l2, d1we3l3
  • Chain 'M':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3m1, d1we3m2, d1we3m3
  • Chain 'N':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3n1, d1we3n2, d1we3n3
  • Chain 'O':
    Compound: cpn10(GroES)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3o_
  • Chain 'P':
    Compound: cpn10(GroES)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3p_
  • Chain 'Q':
    Compound: cpn10(GroES)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3q_
  • Chain 'R':
    Compound: cpn10(GroES)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3r_
  • Chain 'S':
    Compound: cpn10(GroES)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3s_
  • Chain 'T':
    Compound: cpn10(GroES)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3t_
  • Chain 'U':
    Compound: cpn10(GroES)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we3u_
  • Heterogens: MG, ADP, DMS

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1we3A (A:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3A (A:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1we3B (B:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3B (B:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1we3C (C:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3C (C:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1we3D (D:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3D (D:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1we3E (E:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3E (E:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1we3F (F:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3F (F:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekke
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1we3G (G:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3G (G:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1we3H (H:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3H (H:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1we3I (I:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3I (I:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1we3J (J:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3J (J:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1we3K (K:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3K (K:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1we3L (L:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3L (L:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1we3M (M:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3M (M:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1we3N (N:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3N (N:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1we3O (O:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3O (O:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1we3P (P:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3P (P:)
    vikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevke
    gdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1we3Q (Q:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3Q (Q:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1we3R (R:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3R (R:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1we3S (S:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3S (S:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1we3T (T:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3T (T:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1we3U (U:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3U (U:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq