Lineage for d1we3g3 (1we3 G:139-189,G:374-408)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. Protein GroEL, I domain [54851] (4 species)
  7. Species Thermus thermophilus [TaxId:274] [110940] (2 PDB entries)
    Uniprot P61491
  8. Domain d1we3g3: 1we3 G:139-189,G:374-408 [109308]
    Other proteins in same PDB: d1we3a1, d1we3a2, d1we3b1, d1we3b2, d1we3c1, d1we3c2, d1we3d1, d1we3d2, d1we3e1, d1we3e2, d1we3f1, d1we3f2, d1we3g1, d1we3g2, d1we3h1, d1we3h2, d1we3i1, d1we3i2, d1we3j1, d1we3j2, d1we3k1, d1we3k2, d1we3l1, d1we3l2, d1we3m1, d1we3m2, d1we3n1, d1we3n2, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_
    complexed with adp, dms, mg
    complexed with adp, dms, mg

Details for d1we3g3

PDB Entry: 1we3 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
PDB Compounds: (G:) cpn60(GroEL)

SCOPe Domain Sequences for d1we3g3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we3g3 d.56.1.1 (G:139-189,G:374-408) GroEL, I domain {Thermus thermophilus [TaxId: 274]}
edrkaieevatisandpevgkliadamekvgkegiitveesksletelkfvXgvavirvg
aatetelkekkhrfedalnatraavee

SCOPe Domain Coordinates for d1we3g3 are not available.

Timeline for d1we3g3: