Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily) 3-helical bundle packed against 3-stranded mixed beta-sheet |
Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) |
Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein) |
Protein GroEL, I domain [54851] (4 species) |
Species Thermus thermophilus [TaxId:274] [110940] (2 PDB entries) Uniprot P61491 |
Domain d1we3d3: 1we3 D:139-189,D:374-408 [109299] Other proteins in same PDB: d1we3a1, d1we3a2, d1we3b1, d1we3b2, d1we3c1, d1we3c2, d1we3d1, d1we3d2, d1we3e1, d1we3e2, d1we3f1, d1we3f2, d1we3g1, d1we3g2, d1we3h1, d1we3h2, d1we3i1, d1we3i2, d1we3j1, d1we3j2, d1we3k1, d1we3k2, d1we3l1, d1we3l2, d1we3m1, d1we3m2, d1we3n1, d1we3n2, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_ complexed with adp, dms, mg complexed with adp, dms, mg |
PDB Entry: 1we3 (more details), 2.8 Å
SCOPe Domain Sequences for d1we3d3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we3d3 d.56.1.1 (D:139-189,D:374-408) GroEL, I domain {Thermus thermophilus [TaxId: 274]} edrkaieevatisandpevgkliadamekvgkegiitveesksletelkfvXgvavirvg aatetelkekkhrfedalnatraavee
Timeline for d1we3d3:
View in 3D Domains from other chains: (mouse over for more information) d1we3a1, d1we3a2, d1we3a3, d1we3b1, d1we3b2, d1we3b3, d1we3c1, d1we3c2, d1we3c3, d1we3e1, d1we3e2, d1we3e3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_ |