SCOPe 2.08: Domain d1we3o_: 1we3 O:

Lineage for d1we3o_ (1we3 O:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.1: GroES [50130] (2 proteins)
   automatically mapped to Pfam PF00166

6. Protein Chaperonin-10 (GroES) [50131] (4 species)

7. Species Thermus thermophilus [TaxId:274] [110172] (3 PDB entries)
   Uniprot P61493 ! Uniprot P61492

8. Domain d1we3o_: 1we3 O: [109330]
   Other proteins in same PDB: d1we3a1, d1we3a2, d1we3a3, d1we3b1, d1we3b2, d1we3b3, d1we3c1, d1we3c2, d1we3c3, d1we3d1, d1we3d2, d1we3d3, d1we3e1, d1we3e2, d1we3e3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3
   complexed with adp, dms, mg
   complexed with adp, dms, mg

Details for d1we3o_

PDB Entry: 1we3, 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus

PDB Compounds: (O:) cpn10(GroES)

SCOPe Domain Sequences for d1we3o_:

Sequence; same for both SEQRES and ATOM records:

>d1we3o_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
kegdivvfakyggteieidgeeyvilserdllavlq

Timeline for d1we3o_:

• d1we3o_ first appeared in SCOP 1.69
  
• d1we3o_ appears in SCOPe 2.07