Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) |
Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins) |
Protein GroEL, A domain [52031] (4 species) |
Species Thermus thermophilus [TaxId:274] [52033] (3 PDB entries) Uniprot P61491 |
Domain d1we3e2: 1we3 E:190-373 [109301] Other proteins in same PDB: d1we3a1, d1we3a3, d1we3b1, d1we3b3, d1we3c1, d1we3c3, d1we3d1, d1we3d3, d1we3e1, d1we3e3, d1we3f1, d1we3f3, d1we3g1, d1we3g3, d1we3h1, d1we3h3, d1we3i1, d1we3i3, d1we3j1, d1we3j3, d1we3k1, d1we3k3, d1we3l1, d1we3l3, d1we3m1, d1we3m3, d1we3n1, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_ complexed with adp, dms, mg complexed with adp, dms, mg |
PDB Entry: 1we3 (more details), 2.8 Å
SCOPe Domain Sequences for d1we3e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we3e2 c.8.5.1 (E:190-373) GroEL, A domain {Thermus thermophilus [TaxId: 274]} egyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqtgkpllii aedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtviseelgfkle natlsmlgraervritkdettivggkgkkediearingikkelettdseyareklqerla klag
Timeline for d1we3e2:
View in 3D Domains from other chains: (mouse over for more information) d1we3a1, d1we3a2, d1we3a3, d1we3b1, d1we3b2, d1we3b3, d1we3c1, d1we3c2, d1we3c3, d1we3d1, d1we3d2, d1we3d3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_ |