Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.14: KorB DNA-binding domain-like [109709] (2 families) contains HTH motif in the common core; also contains extra N-terminal helix and C-terminal subdomain of 4 helices (left-handed superhelix) |
Family a.4.14.1: KorB DNA-binding domain-like [109710] (2 proteins) [N-terminal half of Pfam PF06613] |
Protein Putative partitioning protein ParB/Spo0J [109713] (1 species) |
Species Thermus thermophilus [TaxId:274] [109714] (1 PDB entry) Uniprot Q9LCY0 # Fragment |
Domain d1vz0f1: 1vz0 F:116-208 [108939] Other proteins in same PDB: d1vz0a2, d1vz0b2, d1vz0c2, d1vz0d2, d1vz0e2, d1vz0f2, d1vz0g2, d1vz0h2 complexed with co, mg |
PDB Entry: 1vz0 (more details), 2.3 Å
SCOPe Domain Sequences for d1vz0f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vz0f1 a.4.14.1 (F:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} edlspveeargyqallemgltqeevarrvgkarstvanalrllqlppealealergeita gharallmlepedrlwglkeilekglsvrqaea
Timeline for d1vz0f1: