SCOPe 2.08: Domain d1vz0g2: 1vz0 G:23-115

Lineage for d1vz0g2 (1vz0 G:23-115)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily)
beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8)
Superfamily d.268.1: ParB/Sulfiredoxin [110849] (5 families)
Family d.268.1.1: ParB-like nuclease domain [110850] (1 protein)
Pfam PF02195
Protein Putative partitioning protein ParB/Spo0J [110851] (1 species)
Species Thermus thermophilus [TaxId:274] [110852] (1 PDB entry)
Uniprot Q9LCY0 # Fragment
Domain d1vz0g2: 1vz0 G:23-115 [108942]
Other proteins in same PDB: d1vz0a1, d1vz0b1, d1vz0c1, d1vz0d1, d1vz0e1, d1vz0f1, d1vz0g1, d1vz0h1
complexed with co, mg

Details for d1vz0g2

PDB Entry: 1vz0 (more details), 2.3 Å

PDB Description: chromosome segregation protein spo0j from thermus thermophilus

PDB Compounds: (G:) Chromosome-partitioning protein Spo0J

SCOPe Domain Sequences for d1vz0g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vz0g2 d.268.1.1 (G:23-115) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]}
vvrlplasirpnprqprkrfaeeslkeladsirekgllqpllvrpqgdgyelvagerryr
aalmaglqevpavvkdltdrealelalvenlqr

SCOPe Domain Coordinates for d1vz0g2:

Click to download the PDB-style file with coordinates for d1vz0g2.
(The format of our PDB-style files is described here.)

Timeline for d1vz0g2: