SCOPe 2.08: Domain d1vz0a1: 1vz0 A:116-208

Lineage for d1vz0a1 (1vz0 A:116-208)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.14: KorB DNA-binding domain-like [109709] (2 families)
   contains HTH motif in the common core; also contains extra N-terminal helix and C-terminal subdomain of 4 helices (left-handed superhelix)

5. Family a.4.14.1: KorB DNA-binding domain-like [109710] (2 proteins)
   [N-terminal half of Pfam PF06613]

6. Protein Putative partitioning protein ParB/Spo0J [109713] (1 species)

7. Species Thermus thermophilus [TaxId:274] [109714] (1 PDB entry)
   Uniprot Q9LCY0 # Fragment

8. Domain d1vz0a1: 1vz0 A:116-208 [108929]
   Other proteins in same PDB: d1vz0a2, d1vz0b2, d1vz0c2, d1vz0d2, d1vz0e2, d1vz0f2, d1vz0g2, d1vz0h2
   complexed with co, mg

Details for d1vz0a1

PDB Entry: 1vz0, 2.3 Å

PDB Description: chromosome segregation protein spo0j from thermus thermophilus

PDB Compounds: (A:) Chromosome-partitioning protein Spo0J

SCOPe Domain Sequences for d1vz0a1:

Sequence; same for both SEQRES and ATOM records:

>d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]}
edlspveeargyqallemgltqeevarrvgkarstvanalrllqlppealealergeita
gharallmlepedrlwglkeilekglsvrqaea

Timeline for d1vz0a1:

• d1vz0a1 first appeared in SCOP 1.69
  
• d1vz0a1 appears in SCOPe 2.07