Lineage for d1vz0a2 (1vz0 A:23-115)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565714Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily)
    beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8)
  4. 2565715Superfamily d.268.1: ParB/Sulfiredoxin [110849] (4 families) (S)
  5. 2565716Family d.268.1.1: ParB-like nuclease domain [110850] (1 protein)
    Pfam PF02195
  6. 2565717Protein Putative partitioning protein ParB/Spo0J [110851] (1 species)
  7. 2565718Species Thermus thermophilus [TaxId:274] [110852] (1 PDB entry)
    Uniprot Q9LCY0 # Fragment
  8. 2565719Domain d1vz0a2: 1vz0 A:23-115 [108930]
    Other proteins in same PDB: d1vz0a1, d1vz0b1, d1vz0c1, d1vz0d1, d1vz0e1, d1vz0f1, d1vz0g1, d1vz0h1
    complexed with co, mg

Details for d1vz0a2

PDB Entry: 1vz0 (more details), 2.3 Å

PDB Description: chromosome segregation protein spo0j from thermus thermophilus
PDB Compounds: (A:) chromosome partitioning protein parb

SCOPe Domain Sequences for d1vz0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vz0a2 d.268.1.1 (A:23-115) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]}
vvrlplasirpnprqprkrfaeeslkeladsirekgllqpllvrpqgdgyelvagerryr
aalmaglqevpavvkdltdrealelalvenlqr

SCOPe Domain Coordinates for d1vz0a2:

Click to download the PDB-style file with coordinates for d1vz0a2.
(The format of our PDB-style files is described here.)

Timeline for d1vz0a2: