Lineage for d1vz0b2 (1vz0 B:23-115)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009272Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily)
    beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8)
  4. 3009273Superfamily d.268.1: ParB/Sulfiredoxin [110849] (5 families) (S)
  5. 3009274Family d.268.1.1: ParB-like nuclease domain [110850] (1 protein)
    Pfam PF02195
  6. 3009275Protein Putative partitioning protein ParB/Spo0J [110851] (1 species)
  7. 3009276Species Thermus thermophilus [TaxId:274] [110852] (1 PDB entry)
    Uniprot Q9LCY0 # Fragment
  8. 3009278Domain d1vz0b2: 1vz0 B:23-115 [108932]
    Other proteins in same PDB: d1vz0a1, d1vz0b1, d1vz0c1, d1vz0d1, d1vz0e1, d1vz0f1, d1vz0g1, d1vz0h1
    complexed with co, mg

Details for d1vz0b2

PDB Entry: 1vz0 (more details), 2.3 Å

PDB Description: chromosome segregation protein spo0j from thermus thermophilus
PDB Compounds: (B:) Chromosome-partitioning protein Spo0J

SCOPe Domain Sequences for d1vz0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vz0b2 d.268.1.1 (B:23-115) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]}
vvrlplasirpnprqprkrfaeeslkeladsirekgllqpllvrpqgdgyelvagerryr
aalmaglqevpavvkdltdrealelalvenlqr

SCOPe Domain Coordinates for d1vz0b2:

Click to download the PDB-style file with coordinates for d1vz0b2.
(The format of our PDB-style files is described here.)

Timeline for d1vz0b2: