PDB entry 1vz0

View 1vz0 on RCSB PDB site
Description: Chromosome segregation protein Spo0J from Thermus thermophilus
Class: nuclear protein
Keywords: nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix
Deposited on 2004-05-12, released 2004-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chromosome partitioning protein parb
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz0a1, d1vz0a2
  • Chain 'B':
    Compound: chromosome partitioning protein parb
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz0b1, d1vz0b2
  • Chain 'C':
    Compound: chromosome partitioning protein parb
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz0c1, d1vz0c2
  • Chain 'D':
    Compound: chromosome partitioning protein parb
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz0d1, d1vz0d2
  • Chain 'E':
    Compound: chromosome partitioning protein parb
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz0e1, d1vz0e2
  • Chain 'F':
    Compound: chromosome partitioning protein parb
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz0f1, d1vz0f2
  • Chain 'G':
    Compound: chromosome partitioning protein parb
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz0g1, d1vz0g2
  • Chain 'H':
    Compound: chromosome partitioning protein parb
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz0h1, d1vz0h2
  • Heterogens: CO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vz0A (A:)
    msrkpsglgrgleallpktgagvvrlplasirpnprqprkrfaeeslkeladsirekgll
    qpllvrpqgdgyelvagerryraalmaglqevpavvkdltdrealelalvenlqredlsp
    veeargyqallemgltqeevarrvgkarstvanalrllqlppealealergeitaghara
    llmlepedrlwglkeilekglsvrqaealrerlamapkrsaegshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz0A (A:)
    vvrlplasirpnprqprkrfaeeslkeladsirekgllqpllvrpqgdgyelvagerryr
    aalmaglqevpavvkdltdrealelalvenlqredlspveeargyqallemgltqeevar
    rvgkarstvanalrllqlppealealergeitagharallmlepedrlwglkeilekgls
    vrqaeal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vz0B (B:)
    msrkpsglgrgleallpktgagvvrlplasirpnprqprkrfaeeslkeladsirekgll
    qpllvrpqgdgyelvagerryraalmaglqevpavvkdltdrealelalvenlqredlsp
    veeargyqallemgltqeevarrvgkarstvanalrllqlppealealergeitaghara
    llmlepedrlwglkeilekglsvrqaealrerlamapkrsaegshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz0B (B:)
    vvrlplasirpnprqprkrfaeeslkeladsirekgllqpllvrpqgdgyelvagerryr
    aalmaglqevpavvkdltdrealelalvenlqredlspveeargyqallemgltqeevar
    rvgkarstvanalrllqlppealealergeitagharallmlepedrlwglkeilekgls
    vrqaealrerlam
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vz0C (C:)
    msrkpsglgrgleallpktgagvvrlplasirpnprqprkrfaeeslkeladsirekgll
    qpllvrpqgdgyelvagerryraalmaglqevpavvkdltdrealelalvenlqredlsp
    veeargyqallemgltqeevarrvgkarstvanalrllqlppealealergeitaghara
    llmlepedrlwglkeilekglsvrqaealrerlamapkrsaegshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz0C (C:)
    vvrlplasirpnprqprkrfaeeslkeladsirekgllqpllvrpqgdgyelvagerryr
    aalmaglqevpavvkdltdrealelalvenlqredlspveeargyqallemgltqeevar
    rvgkarstvanalrllqlppealealergeitagharallmlepedrlwglkeilekgls
    vrqaealrer
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vz0D (D:)
    msrkpsglgrgleallpktgagvvrlplasirpnprqprkrfaeeslkeladsirekgll
    qpllvrpqgdgyelvagerryraalmaglqevpavvkdltdrealelalvenlqredlsp
    veeargyqallemgltqeevarrvgkarstvanalrllqlppealealergeitaghara
    llmlepedrlwglkeilekglsvrqaealrerlamapkrsaegshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz0D (D:)
    vvrlplasirpnprqprkrfaeeslkeladsirekgllqpllvrpqgdgyelvagerryr
    aalmaglqevpavvkdltdrealelalvenlqredlspveeargyqallemgltqeevar
    rvgkarstvanalrllqlppealealergeitagharallmlepedrlwglkeilekgls
    vrqaealrerlam
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vz0E (E:)
    msrkpsglgrgleallpktgagvvrlplasirpnprqprkrfaeeslkeladsirekgll
    qpllvrpqgdgyelvagerryraalmaglqevpavvkdltdrealelalvenlqredlsp
    veeargyqallemgltqeevarrvgkarstvanalrllqlppealealergeitaghara
    llmlepedrlwglkeilekglsvrqaealrerlamapkrsaegshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz0E (E:)
    vvrlplasirpnprqprkrfaeeslkeladsirekgllqpllvrpqgdgyelvagerryr
    aalmaglqevpavvkdltdrealelalvenlqredlspveeargyqallemgltqeevar
    rvgkarstvanalrllqlppealealergeitagharallmlepedrlwglkeilekgls
    vrqaealrerla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vz0F (F:)
    msrkpsglgrgleallpktgagvvrlplasirpnprqprkrfaeeslkeladsirekgll
    qpllvrpqgdgyelvagerryraalmaglqevpavvkdltdrealelalvenlqredlsp
    veeargyqallemgltqeevarrvgkarstvanalrllqlppealealergeitaghara
    llmlepedrlwglkeilekglsvrqaealrerlamapkrsaegshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz0F (F:)
    vvrlplasirpnprqprkrfaeeslkeladsirekgllqpllvrpqgdgyelvagerryr
    aalmaglqevpavvkdltdrealelalvenlqredlspveeargyqallemgltqeevar
    rvgkarstvanalrllqlppealealergeitagharallmlepedrlwglkeilekgls
    vrqaealre
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1vz0G (G:)
    msrkpsglgrgleallpktgagvvrlplasirpnprqprkrfaeeslkeladsirekgll
    qpllvrpqgdgyelvagerryraalmaglqevpavvkdltdrealelalvenlqredlsp
    veeargyqallemgltqeevarrvgkarstvanalrllqlppealealergeitaghara
    llmlepedrlwglkeilekglsvrqaealrerlamapkrsaegshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz0G (G:)
    vvrlplasirpnprqprkrfaeeslkeladsirekgllqpllvrpqgdgyelvagerryr
    aalmaglqevpavvkdltdrealelalvenlqredlspveeargyqallemgltqeevar
    rvgkarstvanalrllqlppealealergeitagharallmlepedrlwglkeilekgls
    vrqaeal
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1vz0H (H:)
    msrkpsglgrgleallpktgagvvrlplasirpnprqprkrfaeeslkeladsirekgll
    qpllvrpqgdgyelvagerryraalmaglqevpavvkdltdrealelalvenlqredlsp
    veeargyqallemgltqeevarrvgkarstvanalrllqlppealealergeitaghara
    llmlepedrlwglkeilekglsvrqaealrerlamapkrsaegshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz0H (H:)
    vvrlplasirpnprqprkrfaeeslkeladsirekgllqpllvrpqgdgyelvagerryr
    aalmaglqevpavvkdltdrealelalvenlqredlspveeargyqallemgltqeevar
    rvgkarstvanalrllqlppealealergeitagharallmlepedrlwglkeilekgls
    vrqaealr