SCOPe 2.08: Domain d1thda1: 1thd A:298-395

Lineage for d1thda1 (1thd A:298-395)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein Envelope glycoprotein [49213] (5 species)

7. Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
   Uniprot P12823 281-675 # 99% sequence identity

8. Domain d1thda1: 1thd A:298-395 [106910]
   Other proteins in same PDB: d1thda2, d1thdb2, d1thdc2

Details for d1thda1

PDB Entry: 1thd

PDB Description: complex organization of dengue virus e protein as revealed by 9.5 angstrom cryo-em reconstruction

PDB Compounds: (A:) major envelope protein E

SCOPe Domain Sequences for d1thda1:

Sequence; same for both SEQRES and ATOM records:

>d1thda1 b.1.18.4 (A:298-395) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlkldwfkkg

Timeline for d1thda1:

• d1thda1 first appeared in SCOP 1.69
  
• d1thda1 appears in SCOPe 2.07