SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1thda1 (1thd A:298-395)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2032497Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 protein domains)
  6. 2032498Protein Envelope glycoprotein [49213] (5 species)
  7. 2032499Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
    Uniprot P12823 281-675 # 99% sequence identity
  8. 2032510Domain d1thda1: 1thd A:298-395 [106910]
    Other proteins in same PDB: d1thda2, d1thdb2, d1thdc2

Details for d1thda1

PDB Entry: 1thd (more details), 9.5 Å

PDB Description: complex organization of dengue virus e protein as revealed by 9.5 angstrom cryo-em reconstruction
PDB Compounds: (A:) major envelope protein E

SCOPe Domain Sequences for d1thda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1thda1 b.1.18.4 (A:298-395) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlkldwfkkg

SCOPe Domain Coordinates for d1thda1:

Click to download the PDB-style file with coordinates for d1thda1.
(The format of our PDB-style files is described here.)

Timeline for d1thda1: