| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
| Protein Envelope glycoprotein [49213] (5 species) |
| Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries) Uniprot P12823 281-675 # 99% sequence identity |
| Domain d1thdb1: 1thd B:298-395 [106912] Other proteins in same PDB: d1thda2, d1thdb2, d1thdc2 |
PDB Entry: 1thd (more details)
SCOPe Domain Sequences for d1thdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1thdb1 b.1.18.4 (B:298-395) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlkldwfkkg
Timeline for d1thdb1:
View in 3DDomains from other chains: (mouse over for more information) d1thda1, d1thda2, d1thdc1, d1thdc2 |