Lineage for d1thdb2 (1thd B:1-297)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576583Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2576584Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2576585Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins)
  6. 2576586Protein Envelope glycoprotein [56985] (2 species)
  7. 2576587Species Dengue virus type 2 [TaxId:11060] [90131] (8 PDB entries)
    Uniprot P12823 281-675
  8. 2576597Domain d1thdb2: 1thd B:1-297 [106913]
    Other proteins in same PDB: d1thda1, d1thdb1, d1thdc1

Details for d1thdb2

PDB Entry: 1thd (more details), 9.5 Å

PDB Description: complex organization of dengue virus e protein as revealed by 9.5 angstrom cryo-em reconstruction
PDB Compounds: (B:) major envelope protein E

SCOPe Domain Sequences for d1thdb2:

Sequence, based on SEQRES records: (download)

>d1thdb2 f.10.1.1 (B:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttdsrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

Sequence, based on observed residues (ATOM records): (download)

>d1thdb2 f.10.1.1 (B:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie
akltntttdsrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck
knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt
mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha
kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

SCOPe Domain Coordinates for d1thdb2:

Click to download the PDB-style file with coordinates for d1thdb2.
(The format of our PDB-style files is described here.)

Timeline for d1thdb2: