Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins) |
Protein Envelope glycoprotein [56985] (2 species) |
Species Dengue virus type 2 [TaxId:11060] [90131] (8 PDB entries) Uniprot P12823 281-675 |
Domain d1thdb2: 1thd B:1-297 [106913] Other proteins in same PDB: d1thda1, d1thdb1, d1thdc1 |
PDB Entry: 1thd (more details)
SCOPe Domain Sequences for d1thdb2:
Sequence, based on SEQRES records: (download)
>d1thdb2 f.10.1.1 (B:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]} mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc ieakltntttdsrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
>d1thdb2 f.10.1.1 (B:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]} mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie akltntttdsrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
Timeline for d1thdb2:
View in 3D Domains from other chains: (mouse over for more information) d1thda1, d1thda2, d1thdc1, d1thdc2 |