Lineage for d1thdc1 (1thd C:298-395)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765451Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2765452Protein Envelope glycoprotein [49213] (5 species)
  7. 2765453Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
    Uniprot P12823 281-675 # 99% sequence identity
  8. 2765469Domain d1thdc1: 1thd C:298-395 [106914]
    Other proteins in same PDB: d1thda2, d1thdb2, d1thdc2

Details for d1thdc1

PDB Entry: 1thd (more details)

PDB Description: complex organization of dengue virus e protein as revealed by 9.5 angstrom cryo-em reconstruction
PDB Compounds: (C:) major envelope protein E

SCOPe Domain Sequences for d1thdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1thdc1 b.1.18.4 (C:298-395) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlkldwfkkg

SCOPe Domain Coordinates for d1thdc1:

Click to download the PDB-style file with coordinates for d1thdc1.
(The format of our PDB-style files is described here.)

Timeline for d1thdc1: