Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
Protein Envelope glycoprotein [49213] (5 species) |
Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries) Uniprot P12823 281-675 # 99% sequence identity |
Domain d1thdc1: 1thd C:298-395 [106914] Other proteins in same PDB: d1thda2, d1thdb2, d1thdc2 |
PDB Entry: 1thd (more details)
SCOPe Domain Sequences for d1thdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1thdc1 b.1.18.4 (C:298-395) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]} sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi vtekdspvnieaeppfgdsyiiigvepgqlkldwfkkg
Timeline for d1thdc1:
View in 3D Domains from other chains: (mouse over for more information) d1thda1, d1thda2, d1thdb1, d1thdb2 |